Protein Info for Rv1267c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein EmbR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF00486: Trans_reg_C" amino acids 31 to 103 (73 residues), 42 bits, see alignment E=1.7e-14 PF03704: BTAD" amino acids 110 to 255 (146 residues), 167.1 bits, see alignment E=6.8e-53 PF16697: Yop-YscD_cpl" amino acids 297 to 379 (83 residues), 45.9 bits, see alignment E=1.1e-15 PF00498: FHA" amino acids 308 to 371 (64 residues), 64.7 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 100% identical to EMBR_MYCTO: Transcriptional regulatory protein EmbR (embR) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_1326c)

Predicted SEED Role

"transcriptional regulator, AfsR/DnrI/RedD family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>Rv1267c Probable transcriptional regulatory protein EmbR (Mycobacterium tuberculosis H37Rv)
MAGSATVEKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALW
EEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKT
AGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEA
EIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLG
IDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRG
YPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSA
VTLNDGDHIRICDHEFTFQISAGTHGGT