Protein Info for Rv1250 in Mycobacterium tuberculosis H37Rv

Annotation: Probable drug-transport integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 86 to 112 (27 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 467 to 487 (21 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 21 to 429 (409 residues), 268.3 bits, see alignment E=6.5e-84 PF07690: MFS_1" amino acids 25 to 415 (391 residues), 180 bits, see alignment E=1.3e-56 PF06609: TRI12" amino acids 39 to 300 (262 residues), 24.8 bits, see alignment E=1.5e-09 PF00083: Sugar_tr" amino acids 55 to 190 (136 residues), 35.7 bits, see alignment E=9.5e-13 PF03209: PUCC" amino acids 100 to 170 (71 residues), 27.4 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 100% identical to Y1250_MYCTU: Uncharacterized MFS-type transporter Rv1250 (Rv1250) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1250)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>Rv1250 Probable drug-transport integral membrane protein (Mycobacterium tuberculosis H37Rv)
MTTAIRRAAGSSYFRNPWPALWAMMVGFFMIMLDSTVVAIANPTIMAQLRIGYATVVWVT
SAYLLAYAVPMLVAGRLGDRFGPKNLYLIGLGVFTVASLGCGLSSGAGMLIAARVVQGVG
AGLLTPQTLSTITRIFPAHRRGVALGAWGTVASVASLVGPLAGGALVDSMGWEWIFFVNV
PVGVIGLILAAYLIPALPHHPHRFDWFGVGLSGAGMFLIVFGLQQGQSANWQPWIWAVIV
GGIGFMSLFVYWQARNAREPLIPLEVFNDRNFSLSNLRIAIIAFAGTGMMLPVTFYAQAV
CGLSPTHTAVLFAPTAIVGGVLAPFVGMIIDRSHPLCVLGFGFSVLAIAMTWLLCEMAPG
TPIWRLVLPFIALGVAGAFVWSPLTVTATRNLRPHLAGASSGVFNAVRQLGAVLGSASMA
AFMTSRIAAEMPGGVDALTGPAGQDATVLQLPEFVREPFAAAMSQSMLLPAFVALFGIVA
ALFLVDFTGAAVAKEPLPESDGDADDDDYVEYILRREPEEDCDTQPLRASRPAAAAASRS
GAGGPLAVSWSTSAQGMPPGPPGRRAWQADTESTAPSAL