Protein Info for Rv1240 in Mycobacterium tuberculosis H37Rv

Annotation: Probable malate dehydrogenase Mdh

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR01759: malate dehydrogenase" amino acids 4 to 322 (319 residues), 480 bits, see alignment E=1.6e-148 PF00056: Ldh_1_N" amino acids 7 to 150 (144 residues), 103.7 bits, see alignment E=9.1e-34 PF02866: Ldh_1_C" amino acids 157 to 323 (167 residues), 142.1 bits, see alignment E=1.9e-45

Best Hits

Swiss-Prot: 100% identical to MDH_MYCTU: Malate dehydrogenase (mdh) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 99% identity to mtf:TBFG_11265)

MetaCyc: 100% identical to malate dehydrogenase (Mycobacterium tuberculosis H37Rv)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.38

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>Rv1240 Probable malate dehydrogenase Mdh (Mycobacterium tuberculosis H37Rv)
VSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALQALEGVVMELDD
CAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAV
AADDVRVGVTGNPANTNALIAMTNAPDIPRERFSALTRLDHNRAISQLAAKTGAAVTDIK
KMTIWGNHSATQYPDLFHAEVAGKNAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSA
ASAASATIDAARDWLLGTPADDWVSMAVVSDGSYGVPEGLISSFPVTTKGGNWTIVSGLE
IDEFSRGRIDKSTAELADERSAVTELGLI