Protein Info for Rv1236 in Mycobacterium tuberculosis H37Rv

Annotation: Probable sugar-transport integral membrane protein ABC transporter SugA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 81 to 109 (29 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 166 to 295 (130 residues), 46.9 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 100% identical to SUGA_MYCTU: Trehalose transport system permease protein SugA (sugA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to mbo:Mb1268)

MetaCyc: 100% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>Rv1236 Probable sugar-transport integral membrane protein ABC transporter SugA (Mycobacterium tuberculosis H37Rv)
VTSVEQRTATAVFSRTGSRMAERRLAFMLVAPAAMLMVAVTAYPIGYALWLSLQRNNLAT
PNDTAFIGLGNYHTILIDRYWWTALAVTLAITAVSVTIEFVLGLALALVMHRTLIGKGLV
RTAVLIPYGIVTVVASYSWYYAWTPGTGYLANLLPYDSAPLTQQIPSLGIVVIAEVWKTT
PFMSLLLLAGLALVPEDLLRAAQVDGASAWRRLTKVILPMIKPAIVVALLFRTLDAFRIF
DNIYVLTGGSNNTGSVSILGYDNLFKGFNVGLGSAISVLIFGCVAVIAFIFIKLFGAAAP
GGEPSGR