Protein Info for Rv1229c in Mycobacterium tuberculosis H37Rv

Annotation: Probable Mrp-related protein Mrp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF01883: FeS_assembly_P" amino acids 20 to 92 (73 residues), 61.4 bits, see alignment E=1.9e-20 PF10609: ParA" amino acids 126 to 370 (245 residues), 286.1 bits, see alignment E=5.8e-89 PF13614: AAA_31" amino acids 127 to 169 (43 residues), 31.2 bits, see alignment 5.3e-11 PF09140: MipZ" amino acids 130 to 248 (119 residues), 31.1 bits, see alignment E=4e-11 PF01656: CbiA" amino acids 130 to 350 (221 residues), 48.5 bits, see alignment E=2.1e-16

Best Hits

Swiss-Prot: 100% identical to APBC_MYCTO: Iron-sulfur cluster carrier protein (mrp) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to mbo:Mb1261c)

Predicted SEED Role

"Mrp protein homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>Rv1229c Probable Mrp-related protein Mrp (Mycobacterium tuberculosis H37Rv)
MPSRLHSAVMSGTRDGDLNAAIRTALGKVIDPELRRPITELGMVKSIDTGPDGSVHVEIY
LTIAGCPKKSEITERVTRAVADVPGTSAVRVSLDVMSDEQRTELRKQLRGDTREPVIPFA
QPDSLTRVYAVASGKGGVGKSTVTVNLAAAMAVRGLSIGVLDADIHGHSIPRMMGTTDRP
TQVESMILPPIAHQVKVISIAQFTQGNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDL
PPGTGDVAISVAQLIPNAELLVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLTL
PDGTTMQVFGEGGGRLVAERLSRAVGADVPLLGQIPLDPALVAAGDSGVPLVLSSPDSAI
GKELHSIADGLSTRRRGLAGMSLGLDPTRR