Protein Info for Rv1220c in Mycobacterium tuberculosis H37Rv

Annotation: Probable methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01596: Methyltransf_3
  • amino acids 41 to 212 (172 residues), 95.9 bits, E=5.1e-31
• PF13847: Methyltransf_31
  • amino acids 57 to 167 (111 residues), 38.2 bits, E=3e-13
• PF13649: Methyltransf_25
  • amino acids 62 to 159 (98 residues), 35.7 bits, E=2.8e-12
• PF08241: Methyltransf_11
  • amino acids 64 to 163 (100 residues), 28.7 bits, E=4.2e-10
• PF13578: Methyltransf_24
  • amino acids 64 to 164 (101 residues), 52.3 bits, E=2.4e-17

Best Hits

Swiss-Prot: 100% identical to Y1220_MYCTU: Putative O-methyltransferase Rv1220c (Rv1220c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to mra:MRA_1229)

MetaCyc: 34% identical to (R)-2-hydroxymalonyl-[acp] 2-O-methyltransferase (Streptomyces hygroscopicus ascomyceticus)
2.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

• (2R)-methoxymalonyl-[acp] biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (215 amino acids)

>Rv1220c Probable methyltransferase (Mycobacterium tuberculosis H37Rv)
MPGQPAPSRGESLWAHAEGSISEDVILAGARERATDIGAGAVTPAVGALLCLLAKLSGGK
AVAEVGTGAGVSGLWLLSGMRDDGVLTTIDIEPEHLRLARQAFAEAGIGPSRTRLISGRA
QEVLTRLADASYDLVFIDADPIDQPDYVAEGVRLLRSGGVIVVHRAALGGRAGDPGARDA
EVIAVREAARLIAEDERLTPALVPLGDGVLAAVRD