Protein Info for Rv1218c in Mycobacterium tuberculosis H37Rv

Annotation: Probable tetronasin-transport ATP-binding protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00005: ABC_tran" amino acids 25 to 163 (139 residues), 98.6 bits, see alignment E=7.1e-32 PF13304: AAA_21" amino acids 133 to 194 (62 residues), 32.7 bits, see alignment E=1.2e-11 PF13732: DrrA1-3_C" amino acids 217 to 295 (79 residues), 31.5 bits, see alignment E=3.6e-11

Best Hits

Swiss-Prot: 100% identical to MEATP_MYCTU: Multidrug efflux system ATP-binding protein Rv1218c (Rv1218c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 99% identity to mtc:MT1256)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>Rv1218c Probable tetronasin-transport ATP-binding protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MSADNHQVPIEIRGLTKHFGSVRALDGLDLTVREGEVHGFLGPNGAGKSTTLRILLGLVK
ADGGSVRLLGGDPWTDAVDLHRHIAYVPGDVTLWPSLTGGETIDLLARMRGGIDNARRAE
LIERFGLDPTKKARTYSKGNRQKVSLISALSSHATLLLLDEPSSGLDPLMENVFQQCIGE
ARQRGVTVLLSSHILAETEALCEKVTIIRAGKTVESGSLDALRHLSRTSIKAEMIGDPGD
LSQIKGVEDISIEGTTVRAQVDSESLRELIQVLGHAGVRSLVSQPPTLEELFLRHYSLGP
EVAAEQQVATP