Protein Info for Rv1216c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 165 to 194 (30 residues), see Phobius details PF06966: DUF1295" amino acids 104 to 213 (110 residues), 23.8 bits, see alignment E=4.4e-09 PF04191: PEMT" amino acids 111 to 204 (94 residues), 42 bits, see alignment E=1.7e-14 PF04140: ICMT" amino acids 133 to 202 (70 residues), 32.9 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1248c)

Predicted SEED Role

"Conserved integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>Rv1216c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MHIGLKIFIWGVLGLVVFGALLFGPAGTFDYWQAWVFLAAFVSTTIGPTIYLARNDPAAL
QRRMRSGPLAEGRTIQKFIVIGAFLGFFAMMVLSACDHRYGWSSVPAAVCVIGDVLVMTG
LGIAMLVVIQNRYAASTVRVEAGQILASDGLYKIVRHPMYAGNVVMMTGIPLALGSYWAM
FILVPGTLVLVFRILDEEKLLTQELSGYREYRQLVRYRLVPYVW