Protein Info for Rv1189 in Mycobacterium tuberculosis H37Rv

Annotation: Possible alternative RNA polymerase sigma factor SigI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 164 (153 residues), 69.4 bits, see alignment E=1.4e-23 PF04542: Sigma70_r2" amino acids 12 to 74 (63 residues), 35.4 bits, see alignment E=7.3e-13 PF08281: Sigma70_r4_2" amino acids 111 to 162 (52 residues), 44.1 bits, see alignment 1.3e-15

Best Hits

Swiss-Prot: 100% identical to SIGI_MYCTO: Probable ECF RNA polymerase sigma factor SigI (sigI) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to mtu:Rv1189)

Predicted SEED Role

"putative RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>Rv1189 Possible alternative RNA polymerase sigma factor SigI (Mycobacterium tuberculosis H37Rv)
MSQHDPVSAAWRAHRAYLVDLAFRMVGDIGVAEDMVQEAFSRLLRAPVGDIDDERGWLIV
VTSRLCLDHIKSASTRRERPQDIAAWHDGDASVSSVDPADRVTLDDEVRLALLIMLERLG
PAERVVFVLHEIFGLPYQQIATTIGSQASTCRQLAHRARRKINESRIAASVEPAQHRVVT
RAFIEACSNGDLDTLLEVLDPGVAGEIDARKGVVVVGADRVGPTILRHWSHPATVLVAQP
VCGQPAVLAFVNRALAGVLALSIEAGKITKIHVLVQPSTLDPLRAELGGG