Protein Info for Rv1175c in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADPH dependent 2,4-dienoyl-CoA reductase FadH (2,4-dienoyl coenzyme A reductase) (4-enoyl-CoA reductase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 PF00724: Oxidored_FMN" amino acids 8 to 332 (325 residues), 270.1 bits, see alignment E=1.3e-83 PF07992: Pyr_redox_2" amino acids 378 to 636 (259 residues), 88 bits, see alignment E=3.2e-28 PF00070: Pyr_redox" amino acids 378 to 458 (81 residues), 27.4 bits, see alignment E=1.6e-09 PF12831: FAD_oxidored" amino acids 379 to 415 (37 residues), 33.7 bits, see alignment 1.1e-11 PF01266: DAO" amino acids 379 to 413 (35 residues), 32.8 bits, see alignment (E = 2.3e-11) PF00890: FAD_binding_2" amino acids 379 to 418 (40 residues), 26 bits, see alignment 2.2e-09 PF13450: NAD_binding_8" amino acids 381 to 435 (55 residues), 39.4 bits, see alignment 2.4e-13 PF01593: Amino_oxidase" amino acids 387 to 413 (27 residues), 20 bits, see alignment (E = 1.5e-07)

Best Hits

KEGG orthology group: K00219, 2,4-dienoyl-CoA reductase (NADPH2) [EC: 1.3.1.34] (inferred from 100% identity to mra:MRA_1186)

Predicted SEED Role

"2,4-dienoyl-CoA reductase [NADPH] (EC 1.3.1.34)" (EC 1.3.1.34)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (674 amino acids)

>Rv1175c Probable NADPH dependent 2,4-dienoyl-CoA reductase FadH (2,4-dienoyl coenzyme A reductase) (4-enoyl-CoA reductase) (Mycobacterium tuberculosis H37Rv)
MTNPYPNLLSPLDLGFTTLRNRVVMGSMHTGLEDRARHIDRLADYFAERARGGVGLIITG
GYAPNRTGWLLPFASELVTSAQARRHRRITRAVHDSGAKILLQILHAGRYAYHPLAVSAS
PIKAPITPFRPRALSARGVEATIADFARCAQLARDAGYDGVEIMGSEGYLLNQFLAPRTN
KRTDSWGGTPANRRRFPVEIIRRSRAAVGCDFIICYRLSMADYVAEGQSWDEIVALATEV
EGAGATIINSGFGWHEARVPTIVTSVPGGAFVDISSAVAEHVTIPVVASNRINMPQAAER
ILAETQVRLISMARPMLSDPDWVLKAQSNRVDEINTCISCNQACLDHAFARKTVSCLLNP
RAGRETQLVLSPTRRARSVAVVGAGPAGLATAANAAQRGHRVTLFEANDFIGGQFDMARR
IPGKEEFSETIRYFSTILAKHGVEVRLGTRVAAQELTGYDEVVLATGVAPRIPAIPGIDH
PMVLTYAEAITGVRPVGRTVAVVGAGGIGFDVTELLVTDSSPTLNLKEWKAEWGVADPRE
ARGALTTPLPAPPAREVYLLQRTKGPQGKRLGKTTGWVHRASLKAKGVHQLSGVNYEQIN
DDGLHISFGPKRRRPQLLAVDNVVVCAGQEPVRDLESELRRHGINPHIIGGAAVAAELDA
KRAIKQGTELAARL