Protein Info for Rv1170 in Mycobacterium tuberculosis H37Rv

Annotation: N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha- D-glucopyranoside deacetylase MshB (GlcNAc-Ins deacetylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR03445: N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase" amino acids 8 to 296 (289 residues), 472.7 bits, see alignment E=3e-146 PF02585: PIG-L" amino acids 8 to 157 (150 residues), 111 bits, see alignment E=3e-36

Best Hits

Swiss-Prot: 100% identical to MSHB_MYCTK: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase (mshB) from Mycobacterium tuberculosis (strain KZN 1435 / MDR)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_02811)

MetaCyc: 100% identical to N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase monomer (Mycobacterium tuberculosis H37Rv)
RXN1G-2 [EC: 3.5.1.103]

Predicted SEED Role

"N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase MshB" in subsystem Glutathione analogs: mycothiol

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>Rv1170 N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha- D-glucopyranoside deacetylase MshB (GlcNAc-Ins deacetylase) (Mycobacterium tuberculosis H37Rv)
MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADH
ADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGA
LVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKF
YWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAA
LAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTA
SGT