Protein Info for Rv1168c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00823: PPE" amino acids 2 to 161 (160 residues), 165.6 bits, see alignment E=1.6e-52 PF21856: EspB_PPE" amino acids 24 to 168 (145 residues), 34.3 bits, see alignment E=3.8e-12 PF12484: PPE-SVP" amino acids 270 to 337 (68 residues), 30.4 bits, see alignment E=9.1e-11

Best Hits

Swiss-Prot: 100% identical to PPE17_MYCTO: Uncharacterized PPE family protein PPE17 (PPE17) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1168c)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>Rv1168c PPE family protein PPE17 (Mycobacterium tuberculosis H37Rv)
MDFTIFPPEFNSLNIQGSARPFLVAANAWKNLSNELSYAASRFESEINGLITSWRGPSST
IMAAAVAPFRAWIVTTASLAELVADHISVVAGAYEAAHAAHVPLPVIETNRLTRLALATT
NIFGIHTPAIFALDALYAQYWSQDGEAMNLYATMAAAAARLTPFSPPAPIANPGALARLY
ELIGSVSETVGSFAAPATKNLPSKLWTLLTKGTYPLTAARISSIPVEYVLAFVEGSNMGQ
MMGNLAMRSLTPTLKGPLELLPNAVRPAVSATLGNADTIGGLSVPPSWVADKSITPLAKA
VPTSAPGGPSGTSWAQLGLASLAGGAVGAVAARTRSGVILRSPAAG