Protein Info for Rv1165 in Mycobacterium tuberculosis H37Rv

Annotation: Possible GTP-binding translation elongation factor TypA (tyrosine phosphorylated protein A) (GTP-binding protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 TIGR01394: GTP-binding protein TypA/BipA" amino acids 3 to 619 (617 residues), 884.6 bits, see alignment E=2.7e-270 PF00009: GTP_EFTU" amino acids 3 to 212 (210 residues), 167.6 bits, see alignment E=5.9e-53 TIGR00231: small GTP-binding protein domain" amino acids 4 to 139 (136 residues), 80.2 bits, see alignment E=1.5e-26 PF03144: GTP_EFTU_D2" amino acids 236 to 309 (74 residues), 47.3 bits, see alignment E=5.5e-16 PF00679: EFG_C" amino acids 417 to 501 (85 residues), 78.2 bits, see alignment E=9.9e-26 PF21018: BipA_C" amino acids 505 to 612 (108 residues), 129.9 bits, see alignment E=8.7e-42

Best Hits

KEGG orthology group: K06207, GTP-binding protein (inferred from 100% identity to mtu:Rv1165)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (628 amino acids)

>Rv1165 Possible GTP-binding translation elongation factor TypA (tyrosine phosphorylated protein A) (GTP-binding protein) (Mycobacterium tuberculosis H37Rv)
VPFRNVAIVAHVDHGKTTLVDAMLRQSGALRERGELQERVMDTGDLEREKGITILAKNTA
VHRHHPDGTVTVINVIDTPGHADFGGEVERGLSMVDGVLLLVDASEGPLPQTRFVLRKAL
AAHLPVILVVNKTDRPDARIAEVVDASHDLLLDVASDLDDEAAAAAEHALGLPTLYASGR
AGVASTTAPPDGQVPDGTNLDPLFEVLEKHVPPPKGEPDAPLQALVTNLDASTFLGRLAL
IRIYNGRIRKGQQVAWIRQVDGQQTVTTAKITELLATEGVERKPTDAAVAGDIVAVAGLP
EIMIGDTLAASANPVALPRITVDEPAISVTIGTNTSPLAGKVGGHKLTARMVRSRLDAEL
VGNVSIRVVDIGAPDAWEVQGRGELALAVLVEQMRREGFELTVGKPQVVTKTIDGTLHEP
FESMTVDCPEEYIGAVTQLMAARKGRMVEMANHTTGWVRMDFVVPSRGLIGWRTDFLTET
RGSGVGHAVFDGYRPWAGEIRARHTGSLVSDRAGAITPFALLQLADRGQFFVEPGQQTYE
GMVVGINPRPEDLDINVTREKKLTNMRSSTADVIETLAKPLQLDLERAMELCAPDECVEV
TPEIVRIRKVELAAAARARSRARTKARG