Protein Info for Rv1163 in Mycobacterium tuberculosis H37Rv

Annotation: Probable respiratory nitrate reductase (delta chain) NarJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00684: nitrate reductase molybdenum cofactor assembly chaperone
  • amino acids 6 to 156 (151 residues), 220 bits, E=7.2e-70
• PF02613: Nitrate_red_del
  • amino acids 36 to 149 (114 residues), 42.4 bits, E=3.7e-15

Best Hits

KEGG orthology group: K00373, nitrate reductase 1, delta subunit [EC: 1.7.99.4] (inferred from 99% identity to mbb:BCG_1225)

Predicted SEED Role

"Respiratory nitrate reductase delta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Protein Sequence (201 amino acids)

>Rv1163 Probable respiratory nitrate reductase (delta chain) NarJ (Mycobacterium tuberculosis H37Rv)
VWQSASLLLAYPDDGLAERLHMVDALRAHQTGPAAALLGRTVAELRALAPMAAAAQYVET
FDMRRRSTMYLTYWTAGDTRNRGREMLAFATAYRDAGVKPPRTEAPDYLPVVLEFAATVD
PEAGRRLLTEHRVPIDVLRGALADAKSPYEYTVAAICETLPAATNQEVRRAQRLAQSGPP
AEAVGLQPFTLTVPPKRAEGA