Protein Info for Rv1159 in Mycobacterium tuberculosis H37Rv
Annotation: Mannosyltransferase PimE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PIME_MYCTO: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase (pimE) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
KEGG orthology group: K13669, alpha-1,2-mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to mra:MRA_1169)MetaCyc: 100% identical to phosphatidylinositol tetramannoside alpha-(1-2)-mannosyltransferase (Mycobacterium tuberculosis H37Rv)
2.4.1.M23 [EC: 2.4.1.M23]
Predicted SEED Role
"probable conserved membrane protein"
MetaCyc Pathways
- phosphatidylinositol mannoside biosynthesis (6/10 steps found)
KEGG Metabolic Maps
- Anthocyanin biosynthesis
- Carotenoid biosynthesis - General
- Flavone and flavonol biosynthesis
- Flavonoid biosynthesis
- Fructose and mannose metabolism
- Glycerolipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- High-mannose type N-glycan biosynthesis
- Keratan sulfate biosynthesis
- Lipopolysaccharide biosynthesis
- N-Glycan biosynthesis
- O-Glycan biosynthesis
- O-Mannosyl glycan biosynthesis
- Peptidoglycan biosynthesis
- Sphingolipid metabolism
- Zeatin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.4.1.-
Use Curated BLAST to search for 2.4.1.- or 2.4.1.M23
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (431 amino acids)
>Rv1159 Mannosyltransferase PimE (Mycobacterium tuberculosis H37Rv) MCRTLIDGPVRSAIAKVRQIDTTSSTPAAARRVTSPPARETRAAVLLLVLSVGARLAWTY LAPNGANFVDLHVYVSGAASLDHPGTLYGYVYADQTPDFPLPFTYPPFAAVVFYPLHLVP FGLIALLWQVVTMAALYGAVRISQRLMGGTAETGHFAAMLWTAIAIWIEPLRSTFDYGQI NVLLMLAALWAVYTPRWWLSGLLVGVASGVKLTPAITAVYLVGVRRLHAAAFSVVVFLAT VGVSLLVVGDEARYYFTDLLGDAGRVGPIATSFNQSWRGAISRILGHDAGFGPLVLAAIA STAVLAILAWRALDRSDRLGKLLVVELFGLLLSPISWTHHWVWLVPLMIWLIDGPARERP GARILGWGWLVLTIVGVPWLLSFAQPSIWQIGRPWYLAWAGLVYVVATLATLGWIAASER YVRIRPRRMAN