Protein Info for Rv1155 in Mycobacterium tuberculosis H37Rv

Annotation: Possible pyridoxamine 5'-phosphate oxidase (PNP/PMP oxidase) (pyridoxinephosphate oxidase) (PNPOX) (pyridoxine 5'-phosphate oxidase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF01243: Putative_PNPOx" amino acids 6 to 91 (86 residues), 60.4 bits, see alignment E=7.9e-21 TIGR03618: PPOX class probable F420-dependent enzyme" amino acids 11 to 141 (131 residues), 128.2 bits, see alignment E=1.1e-41

Best Hits

Swiss-Prot: 100% identical to F420R_MYCTU: F420H(2)-dependent reductase Rv1155 (Rv1155) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_1189)

Predicted SEED Role

"Pyridoxine 5'-phosphate oxidase, Rv1155"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>Rv1155 Possible pyridoxamine 5'-phosphate oxidase (PNP/PMP oxidase) (pyridoxinephosphate oxidase) (PNPOX) (pyridoxine 5'-phosphate oxidase) (Mycobacterium tuberculosis H37Rv)
MARQVFDDKLLAVISGNSIGVLATIKHDGRPQLSNVQYHFDPRKLLIQVSIAEPRAKTRN
LRRDPRASILVDADDGWSYAVAEGTAQLTPPAAAPDDDTVEALIALYRNIAGEHSDWDDY
RQAMVTDRRVLLTLPISHVYGLPPGMR