Protein Info for Rv1145 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane transport protein MmpL13a

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details PF03176: MMPL" amino acids 45 to 276 (232 residues), 132.1 bits, see alignment E=1.2e-42

Best Hits

KEGG orthology group: K06994, putative drug exporter of the RND superfamily (inferred from 100% identity to mtb:TBMG_02837)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>Rv1145 Probable conserved transmembrane transport protein MmpL13a (Mycobacterium tuberculosis H37Rv)
MLQRIARLAIAAPRRIIGFAVFVFIAAAVFGVPVADSLSPGGFQDPRSESARAIEVLTDK
FGQSGQKMLIVVTAAAGADSPPAREVGTDIVEVLRRSPLVYNVTSPWTVPPTAAADLLST
DGKSGLIVVNVKGGENDAQNHAQTLSDEVAHDRDGVTVRAGGSAMEYAQINRQNKDDLLV
MELIAIPLSFLVLIWVFGGLLAAGLPMAQAVLAVVGSMAVLRLVTFATEVSTFALNLSTA
LGLALAIDYTLLIVSRYRDELAEGSDRDEALIRTMALRGARCCFRRSPWRCRCRRLRCSR
CTF