Protein Info for Rv1135c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00823: PPE" amino acids 3 to 165 (163 residues), 201.6 bits, see alignment E=8.6e-64 PF01469: Pentapeptide_2" amino acids 209 to 248 (40 residues), 42.3 bits, see alignment 5.6e-15 amino acids 249 to 288 (40 residues), 29.1 bits, see alignment 7.3e-11 amino acids 279 to 317 (39 residues), 36.4 bits, see alignment 3.8e-13 amino acids 289 to 327 (39 residues), 36.8 bits, see alignment 3e-13 amino acids 315 to 352 (38 residues), 28.5 bits, see alignment 1.2e-10 amino acids 358 to 394 (37 residues), 31.1 bits, see alignment 1.7e-11 amino acids 397 to 435 (39 residues), 36.4 bits, see alignment 3.8e-13 amino acids 426 to 464 (39 residues), 32.5 bits, see alignment 6.4e-12 amino acids 467 to 502 (36 residues), 36 bits, see alignment 5.3e-13

Best Hits

Swiss-Prot: 100% identical to PPE16_MYCTU: Uncharacterized PPE family protein PPE16 (PPE16) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1135c)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (618 amino acids)

>Rv1135c PPE family protein PPE16 (Mycobacterium tuberculosis H37Rv)
MSFLVLPPEVNSALMFAGAGSGPTLAAAAAWDGLAAELGQAANSFSSATAALADTAWQGP
AATAMAAAAAPYASWLSTAATRALSAAAQAKAAAAVYEAARAATVDPLLVAANRHQLVSL
VLSNLFGQNAPAIAATEAAYEQLWAADVAAMVSYHSGASAVAAQLAPWAQAVRALPNPTA
PALASGPAALAIPALGIGNTGIGNIFSIGNIGDYNLGNGNTGNANLGSGNTGQANLGSGN
TGFFNFGSGNTANTNFGSGNLGNLNLGSGNDGNGNFGLGNIGDGNRGSGNVGSFNFGTAN
AGSFNVGSANHGSPNVGFANLGNNNLGIANLGNNNLGIANLGNNNIGIGLTGDNMIGIGA
LNSGIGNLGFGNSGNNNIGLFNSGNNNIGFFNSGDSNFGFFNSGDTNTGFGNAGFTNTGF
GNAGSGNFGFGNAGNNNFGFGNSGFENMGVGNSGAYNTGSFNSGTLNTGDLNSGDFNTGW
ANSGDINTGGFHSGDLNTGFGSPVDQPVMNSGFGNIGTGNSGFNNSGDANSGFQNTNTGA
FFIGHSGLLNSGGGQHVGISNSGTGFNTGLFNTGFNNTGIGNSATNAAFTTTSGVANSGD
NSSGGFNAGNDQSGFFDG