Protein Info for Rv1131 in Mycobacterium tuberculosis H37Rv

Annotation: Probable methylcitrate synthase PrpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01800: 2-methylcitrate synthase/citrate synthase II
  • amino acids 30 to 387 (358 residues), 461.4 bits, E=9e-143
• PF00285: Citrate_synt
  • amino acids 31 to 377 (347 residues), 416.1 bits, E=6.1e-129

Best Hits

Swiss-Prot: 100% identical to PRPC_MYCTE: 2-methylcitrate synthase (gltA1) from Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)

KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 100% identity to mbt:JTY_1165)

MetaCyc: 40% identical to citrate synthase (Haloarcula marismortui)
Citrate (Si)-synthase. [EC: 2.3.3.1, 2.3.3.16, 2.3.3.3]

Predicted SEED Role

"2-methylcitrate synthase (EC 2.3.3.5)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 2.3.3.5)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• TCA cycle VI (Helicobacter) (9/9 steps found)
• glyoxylate cycle (6/6 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• mixed acid fermentation (13/16 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• 2-methylcitrate cycle I (4/5 steps found)
• nitrogen remobilization from senescing leaves (6/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• TCA cycle III (animals) (7/10 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 2-methylcitrate cycle II (3/6 steps found)
• methylaspartate cycle (11/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.1

Use Curated BLAST to search for 2.3.3.1 or 2.3.3.16 or 2.3.3.3 or 2.3.3.5

Protein Sequence (393 amino acids)

>Rv1131 Probable methylcitrate synthase PrpC (Mycobacterium tuberculosis H37Rv)
MTGPLAAARSVAATKSMTAPTVDERPDIKKGLAGVVVDTTAISKVVPQTNSLTYRGYPVQ
DLAARCSFEQVAFLLWRGELPTDAELALFSQRERASRRVDRSMLSLLAKLPDNCHPMDVV
RTAISYLGAEDPDEDDAAANRAKAMRMMAVLPTIVAIDMRRRRGLPPIAPHSGLGYAQNF
LHMCFGEVPETAVVSAFEQSMILYAEHGFNASTFAARVVTSTQSDIYSAVTGAIGALKGR
LHGGANEAVMHDMIEIGDPANAREWLRAKLARKEKIMGFGHRVYRHGDSRVPTMKRALER
VGTVRDGQRWLDIYQVLAAEMASATGILPNLDFPTGPAYYLMGFDIASFTPIFVMSRITG
WTAHIMEQATANALIRPLSAYCGHEQRVLPGTF