Protein Info for Rv1122 in Mycobacterium tuberculosis H37Rv

Annotation: Probable 6-phosphogluconate dehydrogenase,decarboxylating Gnd2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR00872: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 1 to 340 (340 residues), 537 bits, see alignment E=5.7e-166 PF03446: NAD_binding_2" amino acids 2 to 155 (154 residues), 128.2 bits, see alignment E=6.3e-41 PF03807: F420_oxidored" amino acids 3 to 94 (92 residues), 25.4 bits, see alignment E=3.6e-09 PF02254: TrkA_N" amino acids 6 to 44 (39 residues), 22.8 bits, see alignment 2e-08 PF00393: 6PGD" amino acids 186 to 214 (29 residues), 37.7 bits, see alignment (E = 3.3e-13)

Best Hits

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 100% identity to mtu:Rv1122)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.44

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>Rv1122 Probable 6-phosphogluconate dehydrogenase,decarboxylating Gnd2 (Mycobacterium tuberculosis H37Rv)
MQLGMIGLGRMGANIVRRLAKGGHDCVVYDHDPDAVKAMAGEDRTTGVASLRELSQRLSA
PRVVWVMVPAGNITTAVIEELANTLEAGDIVIDGGNTYYRDDLRHEKLLFKKGIHLLDCG
TSGGVWGRERGYCLMIGGDGDAFARAEPIFATVAPGVAAAPRTPGRDGEVAPSEQGYLHC
GPCGSGHFVKMVHNGIEYGMMASLAEGLNILRNADVGTRVQHGDAETAPLPNPECYQYDF
DIPEVAEVWRRGSVIGSWLLDLTAIALRESPDLAEFSGRVSDSGEGRWTAIAAIDEGVPA
PVLTTALQSRFASRDLDDFANKALSAMRKQFGGHAEKPAN