Protein Info for Rv1112 in Mycobacterium tuberculosis H37Rv

Annotation: Probable GTP binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00092: GTP-binding protein YchF" amino acids 3 to 357 (355 residues), 426.3 bits, see alignment E=5.4e-132 PF01926: MMR_HSR1" amino acids 5 to 112 (108 residues), 79 bits, see alignment E=4.4e-26 PF02421: FeoB_N" amino acids 6 to 47 (42 residues), 35.1 bits, see alignment 1.4e-12 PF06071: YchF-GTPase_C" amino acids 273 to 356 (84 residues), 132.7 bits, see alignment E=6.4e-43

Best Hits

KEGG orthology group: K06942, (no description) (inferred from 99% identity to mbt:JTY_1145)

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>Rv1112 Probable GTP binding protein (Mycobacterium tuberculosis H37Rv)
VSLSLGIVGLPNVGKSTLFNALTRNNVVAANYPFATIEPNEGVVSLPDPRLDKLAELFGS
QRVVPAPVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAICQVVRVFVDDDVTHVTGRVD
PQSDIEVVETELILADLQTLERATGRLEKEARTNKARKPVYDAALRAQQVLDAGKTLFAA
GVDAAALRELNLLTTKPFLYVFNADEAVLTDPARVGELRALVAPADAVFLDAAIESELTE
LDDESAAELLESIGQSERGLDALARAGFHTLKLQTFLTAGPKEARAWTIHQGDTAPKAAG
VIHSDFEKGFIKAEIVSYDDLVAAGSMAAAKAAGKVRIEGKDYVMADGDVVEFRFNV