Protein Info for Rv1108c in Mycobacterium tuberculosis H37Rv

Annotation: Probable exodeoxyribonuclease VII (large subunit) XseA (exonuclease VII large subunit)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 12 to 406 (395 residues), 361.2 bits, see alignment E=3.8e-112 PF13742: tRNA_anti_2" amino acids 12 to 105 (94 residues), 51 bits, see alignment E=1.4e-17 PF02601: Exonuc_VII_L" amino acids 128 to 335 (208 residues), 206.7 bits, see alignment E=6.6e-65

Best Hits

Swiss-Prot: 100% identical to EX7L_MYCBO: Exodeoxyribonuclease 7 large subunit (xseA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to mtc:MT1139)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>Rv1108c Probable exodeoxyribonuclease VII (large subunit) XseA (exonuclease VII large subunit) (Mycobacterium tuberculosis H37Rv)
VTQNSAENPFPVRAVAIRVAGWIDKLGAVWVEGQLAQITMRPDAKTVFMVLRDPAADMSL
TVTCSRDLVLSAPVKLAEGVQVVVCGKPSFYTGRGTFSLRLSEIRAVGIGELLARIDRLR
RLLDAEGLFDPRLKRPIPYLPNMIGLITGRASAAERDVTTVASARWPAARFAVRNVAVQG
PNAVGQIVEALRELDRDPDVDVIVLARGGGSVEDLLPFSDETLCRAIAACRTPVVSAVGH
EPDNPLCDLVVDLRAATPTDAAKKVVPDTAAEQRLIDDLRRRSAQALRNWVSREQRAVAQ
LRSRPVLADPMTMVSVRAEEVHRARSTLRRNLTLMVAAETERIGHLAARLATLGPAATLA
RGYAIVQTVAQTGPEGGSEPQVLRSVHDAPEGTKLRVRVADGALAAVSEGQTNGL