Protein Info for Rv1101c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 310 to 341 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 13 to 345 (333 residues), 223.4 bits, see alignment E=2.3e-70

Best Hits

Swiss-Prot: 100% identical to Y1101_MYCTO: Putative transport protein MT1133 (MT1133) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1101c)

Predicted SEED Role

"CONSERVED MEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>Rv1101c Conserved membrane protein (Mycobacterium tuberculosis H37Rv)
LNTEFTLTQKRALAILTLIALLFGAYFLRNYFVLIVVAAVGAYLFTPLFKWFTKRFNTGL
SAACTLLSALAAVVVPVGALVGLAIVQIARMVDSVADWVRTTDLSTLGDKILQFVNGLFD
RVPFLHITVTADALRKAMISVAQNVGEWLLHFLRDAAGSLAGVITSAIIFVYVFVALLVN
REKLRTLIGQLNPLGEDVTDLYLQKMGSMVRGTVNGQFVIAACQGVAGAASIYIAGFHHG
FFIFAIVLTALSIIPLGGGIVTIPFGIGMIFYGNIAGGIFVLLWHLLVVTNIDNVLRPIL
VPRDARLNSALMLLSVFAGITMFGPWGIIIGPVLMILIVTTIDVYLAVYKGVELEQFEAP
PVRRRWLPRRGPATSRNAPPPSTAE