Protein Info for Rv1086 in Mycobacterium tuberculosis H37Rv

Annotation: Short (C15) chain Z-isoprenyl diphosphate synthase (Z-FPP synthase) (Z-farnesyl diphosphate synthase) (Z-FPP synthetase) (Z-farnesyl diphosphate synthetase) (geranyltranstransferase) (farnesyl pyrophosphate synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 31 to 261 (231 residues), 200.6 bits, see alignment E=1.2e-63 PF01255: Prenyltransf" amino acids 39 to 261 (223 residues), 228.1 bits, see alignment E=4.8e-72

Best Hits

Swiss-Prot: 100% identical to ZFPP_MYCTU: (2Z,6E)-farnesyl diphosphate synthase (Rv1086) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K12503, short-chain Z-isoprenyl diphosphate synthase [EC: 2.5.1.68] (inferred from 99% identity to mbt:JTY_1117)

MetaCyc: 100% identical to Z-farnesyl diphosphate synthase (Mycobacterium tuberculosis H37Rv)
Z-farnesyl diphosphate synthase. [EC: 2.5.1.68]

Predicted SEED Role

"(2E,6Z)-farnesyl diphosphate synthase (EC 2.5.1.68)" (EC 2.5.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>Rv1086 Short (C15) chain Z-isoprenyl diphosphate synthase (Z-FPP synthase) (Z-farnesyl diphosphate synthase) (Z-FPP synthetase) (Z-farnesyl diphosphate synthetase) (geranyltranstransferase) (farnesyl pyrophosphate synthetase) (Mycobacterium tuberculosis H37Rv)
VEIIPPRLKEPLYRLYELRLRQGLAASKSDLPRHIAVLCDGNRRWARSAGYDDVSYGYRM
GAAKIAEMLRWCHEAGIELATVYLLSTENLQRDPDELAALIEIITDVVEEICAPANHWSV
RTVGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGRREIVDAVRALLSKELANGA
TAEELVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPA
FRHVDFLRALRDYSARHRSYGR