Protein Info for Rv1082 in Mycobacterium tuberculosis H37Rv

Annotation: Mycothiol conjugate amidase Mca (mycothiol S-conjugate amidase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 TIGR03446: mycothiol conjugate amidase Mca" amino acids 4 to 286 (283 residues), 511.7 bits, see alignment E=3.1e-158 PF02585: PIG-L" amino acids 7 to 152 (146 residues), 106.5 bits, see alignment E=7.6e-35

Best Hits

Swiss-Prot: 100% identical to MCA_MYCTU: Mycothiol S-conjugate amidase (mca) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_11100)

MetaCyc: 100% identical to mycothiol S-conjugate amidase (Mycobacterium tuberculosis H37Rv)
RXN1G-186 [EC: 3.5.1.115]

Predicted SEED Role

"Mycothiol S-conjugate amidase Mca" in subsystem Glutathione analogs: mycothiol

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>Rv1082 Mycothiol conjugate amidase Mca (mycothiol S-conjugate amidase) (Mycobacterium tuberculosis H37Rv)
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDLPDVHGR
IAEIRRDEMTKAAEILGVEHTWLGFVDSGLPKGDLPPPLPDDCFARVPLEVSTEALVRVV
REFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDFCRFPDAGEPWTVSKLYYVHGF
LRERMQMLQDEFARHGQRGPFEQWLAYWDPDHDFLTSRVTTRVECSKYFSQRDDALRAHA
TQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPARPPETELFAGIEP