Protein Info for Rv1077 in Mycobacterium tuberculosis H37Rv

Annotation: Probable cystathionine beta-synthase Cbs (serine sulfhydrase) (beta-thionase) (hemoprotein H-450)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01137: cystathionine beta-synthase
  • amino acids 3 to 458 (456 residues), 698.5 bits, E=1.7e-214
• PF00291: PALP
  • amino acids 7 to 296 (290 residues), 242 bits, E=9.1e-76
• PF00571: CBS
  • amino acids 343 to 396 (54 residues), 25.5 bits, 1.4e-09
  • amino acids 407 to 458 (52 residues), 27.5 bits, 3.4e-10

Best Hits

Swiss-Prot: 100% identical to Y1077_MYCTU: Putative cystathionine beta-synthase Rv1077 (cbs) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 100% identity to mra:MRA_1087)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• taurine biosynthesis III (1/3 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Protein Sequence (464 amino acids)

>Rv1077 Probable cystathionine beta-synthase Cbs (serine sulfhydrase) (beta-thionase) (hemoprotein H-450) (Mycobacterium tuberculosis H37Rv)
MRIAQHISELIGGTPLVRLNSVVPDGAGTVAAKVEYLNPGGSSKDRIAVKMIEAAEASGQ
LKPGGTIVEPTSGNTGVGLALVAQRRGYKCVFVCPDKVSEDKRNVLIAYGAEVVVCPTAV
PPHDPASYYSVSDRLVRDIDGAWKPDQYANPEGPASHYVTTGPEIWADTEGKVTHFVAGI
GTGGTITGAGRYLKEVSGGRVRIVGADPEGSVYSGGAGRPYLVEGVGEDFWPAAYDPSVP
DEIIAVSDSDSFDMTRRLAREEAMLVGGSCGMAVVAALKVAEEAGPDALIVVLLPDGGRG
YMSKIFNDAWMSSYGFLRSRLDGSTEQSTVGDVLRRKSGALPALVHTHPSETVRDAIGIL
REYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRAKLADAVSAHMSPPLRMIGAG
ELVSAAGKALRDWDALMVVEEGKPVGVITRYDLLGFLSEGAGRR