Protein Info for Rv1071c in Mycobacterium tuberculosis H37Rv

Annotation: Possible enoyl-CoA hydratase EchA9 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 13 to 194 (182 residues), 101.4 bits, E=5.6e-33
• PF16113: ECH_2
  • amino acids 16 to 336 (321 residues), 403.5 bits, E=9.5e-125

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to mbo:Mb1100c)

MetaCyc: 100% identical to steroid enoyl-CoA hydratase (Mycobacterium tuberculosis H37Rv)

Predicted SEED Role

"3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 3.1.2.4)

MetaCyc Pathways

• oleate β-oxidation (27/35 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
• L-valine degradation I (7/8 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• β-alanine biosynthesis II (5/6 steps found)
• adipate biosynthesis (4/5 steps found)
• adipate degradation (4/5 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• valproate β-oxidation (6/9 steps found)
• acrylate degradation I (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• propanoyl-CoA degradation II (3/5 steps found)
• fatty acid β-oxidation I (generic) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• superpathway of phenylethylamine degradation (4/11 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• phenylacetate degradation I (aerobic) (2/9 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• platensimycin biosynthesis (7/26 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 3.1.2.4 or 4.2.1.17

Protein Sequence (345 amino acids)

>Rv1071c Possible enoyl-CoA hydratase EchA9 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (Mycobacterium tuberculosis H37Rv)
VTGESHEVLTNVEGGVGFVTLNRPKAINSLNQTMVDLLATVLMSWEHEDAVHAVVLSGAG
ERGLCAGGDVVAVYHSARKDGVEARRFWRHEYLLNALIGRFAKPYVALMDGIVMGGGVGV
SAHANTRVVTDTSKVAMPEVGIGFIPDVGGVYLLSRAPGALGLHAALTGAPFSGADAIAL
GFADHFVPHGDLDAFTQKIVTGGVESALAAHAVEPPPSTLAAQRDWIDECYAGDSVADIV
AALRKQGGEPAVNASDLIASRSPIALSVTLQAVRRAAKLDTLEDVLIQDYRVSSASLRSH
DLVEGIRAQLIDKDRNPNWSPATLDAITAADIEAYFEPVDDDLSF