Protein Info for Rv1070c in Mycobacterium tuberculosis H37Rv

Annotation: Probable enoyl-CoA hydratase EchA8 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00378: ECH_1" amino acids 10 to 256 (247 residues), 274 bits, see alignment E=1.1e-85 PF16113: ECH_2" amino acids 14 to 185 (172 residues), 123.7 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 100% identical to ECHA8_MYCBO: Probable enoyl-CoA hydratase echA8 (echA8) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to mtb:TBMG_02917)

MetaCyc: 62% identical to acryloyl-CoA hydratase (Ruegeria pomeroyi DSS-3)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>Rv1070c Probable enoyl-CoA hydratase EchA8 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (Mycobacterium tuberculosis H37Rv)
MTYETILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKA
FAAGADIKEMADLTFADAFTADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVV
PADDLLTEARATATTISQMSASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATEDQS
EGMAAFIEKRAPQFTHR