Protein Info for Rv1017c in Mycobacterium tuberculosis H37Rv

Annotation: Probable ribose-phosphate pyrophosphokinase PrsA (phosphoribosyl pyrophosphate synthetase) (PRPP synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF13793: Pribosyltran_N" amino acids 12 to 128 (117 residues), 166 bits, see alignment E=4.3e-53 TIGR01251: ribose-phosphate diphosphokinase" amino acids 13 to 323 (311 residues), 400.9 bits, see alignment E=1.5e-124 PF00156: Pribosyltran" amino acids 161 to 263 (103 residues), 63 bits, see alignment E=3.1e-21 PF14572: Pribosyl_synth" amino acids 216 to 322 (107 residues), 74.3 bits, see alignment E=1.9e-24

Best Hits

Swiss-Prot: 100% identical to KPRS_MYCTO: Ribose-phosphate pyrophosphokinase (prs) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 100% identity to mtf:TBFG_11035)

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>Rv1017c Probable ribose-phosphate pyrophosphokinase PrsA (phosphoribosyl pyrophosphate synthetase) (PRPP synthetase) (Mycobacterium tuberculosis H37Rv)
LSHDWTDNRKNLMLFAGRAHPELAEQVAKELDVHVTSQDAREFANGEIFVRFHESVRGCD
AFVLQSCPAPVNRWLMEQLIMIDALKRGSAKRITAVMPFYPYARQDKKHRGREPISARLI
ADLLKTAGADRIVTVDLHTDQIQGFFDGPVDHMRGQNLLTGYIRDNYPDGNMVVVSPDSG
RVRIAEKWADALGGVPLAFIHKTRDPRVPNQVVSNRVVGDVAGRTCVLIDDMIDTGGTIA
GAVALLHNDGAGDVIIAATHGVLSDPAAQRLASCGAREVIVTNTLPIGEDKRFPQLTVLS
IAPLLASTIRAVFENGSVTGLFDGDA