Protein Info for Rv1016c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved lipoprotein LpqT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF10738: Lpp-LpqN" amino acids 57 to 224 (168 residues), 212.2 bits, see alignment E=1.9e-67

Best Hits

Swiss-Prot: 100% identical to LPQT_MYCTO: Putative lipoprotein LpqT (lpqT) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_02971)

Predicted SEED Role

"Lipoprotein LpqT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>Rv1016c Probable conserved lipoprotein LpqT (Mycobacterium tuberculosis H37Rv)
LAGRRCPQDSVRPLAVAVAVATLAMSAVACGPKSPDFQSILSTSPTTSAVSTTTEVPVPL
WKYLESVGVTGEPVAPSSLTDLTVSIPTPPGWAPMKNPNITPNTEMIAKGESYPTAMLMV
FKLHRDFDIAEALKHGTADARLSTNFTELDSSTADFNGFPSSMIQGSYDLHGRRLHTWNR
IVFPTGAPPAKQRYLVQLTITSLANEAVKHASDIEAIIAGFVVAAK