Protein Info for Rv1014c in Mycobacterium tuberculosis H37Rv

Annotation: Probable peptidyl-tRNA hydrolase Pth

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR00447: aminoacyl-tRNA hydrolase" amino acids 5 to 189 (185 residues), 196.4 bits, see alignment E=1.8e-62 PF01195: Pept_tRNA_hydro" amino acids 6 to 189 (184 residues), 224.9 bits, see alignment E=3.5e-71

Best Hits

Swiss-Prot: 100% identical to PTH_MYCTA: Peptidyl-tRNA hydrolase (pth) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K01056, peptidyl-tRNA hydrolase, PTH1 family [EC: 3.1.1.29] (inferred from 100% identity to mtc:MT1042)

Predicted SEED Role

"Peptidyl-tRNA hydrolase (EC 3.1.1.29)" (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>Rv1014c Probable peptidyl-tRNA hydrolase Pth (Mycobacterium tuberculosis H37Rv)
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSL
VLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRS
VVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQG
MEPAQNRVHAW