Protein Info for Rv1013 in Mycobacterium tuberculosis H37Rv
Annotation: Putative polyketide synthase Pks16
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y1013_MYCTU: Putative ligase Rv1013 (pks16) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 100% identity to mtf:TBFG_11031)Predicted SEED Role
"Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.3)
MetaCyc Pathways
- superpathway of fatty acid biosynthesis II (plant) (34/43 steps found)
- oleate β-oxidation (27/35 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (24/31 steps found)
- superpathway of fatty acids biosynthesis (E. coli) (39/53 steps found)
- fatty acid salvage (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- γ-linolenate biosynthesis II (animals) (2/2 steps found)
- octane oxidation (4/5 steps found)
- long-chain fatty acid activation (1/1 steps found)
- phytol degradation (3/4 steps found)
- oleate biosynthesis I (plants) (2/3 steps found)
- stearate biosynthesis IV (4/6 steps found)
- linoleate biosynthesis II (animals) (1/2 steps found)
- long chain fatty acid ester synthesis (engineered) (2/4 steps found)
- alkane biosynthesis II (1/3 steps found)
- 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
- phosphatidylcholine acyl editing (1/4 steps found)
- wax esters biosynthesis II (1/4 steps found)
- 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
- arachidonate biosynthesis III (6-desaturase, mammals) (2/7 steps found)
- ceramide degradation by α-oxidation (2/7 steps found)
- icosapentaenoate biosynthesis II (6-desaturase, mammals) (2/7 steps found)
- sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
- stearate biosynthesis I (animals) (1/6 steps found)
- 2-deoxy-D-ribose degradation II (2/8 steps found)
- capsaicin biosynthesis (1/7 steps found)
- icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
- palmitate biosynthesis III (16/29 steps found)
- ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
- sporopollenin precursors biosynthesis (4/18 steps found)
- cutin biosynthesis (1/16 steps found)
- suberin monomers biosynthesis (2/20 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis II
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Caprolactam degradation
- Ethylbenzene degradation
- Fatty acid metabolism
- Geraniol degradation
- Limonene and pinene degradation
- Propanoate metabolism
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 6.2.1.-, 6.2.1.3
Use Curated BLAST to search for 6.2.1.- or 6.2.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (544 amino acids)
>Rv1013 Putative polyketide synthase Pks16 (Mycobacterium tuberculosis H37Rv) LSRFTEKMFHNARTATTGMVTGEPHMPVRHTWGEVHERARCIAGGLAAAGVGLGDVVGVL AGFPVEIAPTAQALWMRGASLTMLHQPTPRTDLAVWAEDTMTVIGMIEAKAVIVSEPFLV AIPILEQKGMQVLTVADLLASDPIGPIEVGEDDLALMQLTSGSTGSPKAVQITHRNIYSN AEAMFVGAQYDVDKDVMVSWLPCFHDMGMVGFLTIPMFFGAELVKVTPMDFLRDTLLWAK LIDKYQGTMTAAPNFAYALLAKRLRRQAKPGDFDLSTLRFALSGAEPVEPADVEDLLDAG KPFGLRPSAILPAYGMAETTLAVSFSECNAGLVVDEVDADLLAALRRAVPATKGNTRRLA TLGPLLQDLEARIIDEQGDVMPARGVGVIELRGESLTPGYLTMGGFIPAQDEHGWYDTGD LGYLTEEGHVVVCGRVKDVIIMAGRNIYPTDIERAAGRVDGVRPGCAVAVRLDAGHSRES FAVAVESNAFEDPAEVRRIEHQVAHEVVAEVDVRPRNVVVLGPGTIPKTPSGKLRRANSV TLVT