Protein Info for Rv1009 in Mycobacterium tuberculosis H37Rv

Annotation: Probable resuscitation-promoting factor RpfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03990: DUF348" amino acids 27 to 66 (40 residues), 36 bits, see alignment 6.7e-13 amino acids 85 to 110 (26 residues), 24.6 bits, see alignment (E = 2.4e-09) amino acids 141 to 180 (40 residues), 34.4 bits, see alignment 2.2e-12 PF07501: G5" amino acids 198 to 271 (74 residues), 65 bits, see alignment E=9.3e-22 PF06737: Transglycosylas" amino acids 283 to 355 (73 residues), 119 bits, see alignment E=1.7e-38

Best Hits

Swiss-Prot: 100% identical to RPFB_MYCTE: Resuscitation-promoting factor RpfB (rpfB) from Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)

KEGG orthology group: None (inferred from 100% identity to mtc:MT1038)

Predicted SEED Role

"Cell wall-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>Rv1009 Probable resuscitation-promoting factor RpfB (Mycobacterium tuberculosis H37Rv)
MLRLVVGALLLVLAFAGGYAVAACKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRD
DLYPAAGVQVHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLAMTDTAPAAA
SRASRVPLSGMALPVVSAKTVQLNDGGLVRTVHLPAPNVAGLLSAAGVPLLQSDHVVPAA
TAPIVEGMQIQVTRNRIKKVTERLPLPPNARRVEDPEMNMSREVVEDPGVPGTQDVTFAV
AEVNGVETGRLPVANVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAIN
TGNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTRLRQGWGAWPVCAARAG
AR