Protein Info for Rv1007c in Mycobacterium tuberculosis H37Rv

Annotation: Methionyl-tRNA synthetase MetS (MetRS) (methionine--tRNA ligase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF09334: tRNA-synt_1g" amino acids 4 to 137 (134 residues), 139.4 bits, see alignment E=2.9e-44 amino acids 149 to 362 (214 residues), 216.7 bits, see alignment E=9.2e-68 TIGR00398: methionine--tRNA ligase" amino acids 4 to 483 (480 residues), 477.3 bits, see alignment E=3.2e-147 PF00133: tRNA-synt_1" amino acids 5 to 57 (53 residues), 27.5 bits, see alignment 2.7e-10 amino acids 222 to 335 (114 residues), 51.2 bits, see alignment E=1.8e-17 PF19303: Anticodon_3" amino acids 374 to 508 (135 residues), 39.4 bits, see alignment E=1.2e-13

Best Hits

Swiss-Prot: 100% identical to SYM_MYCTU: Methionine--tRNA ligase (metG) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 100% identity to mbb:BCG_1064c)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>Rv1007c Methionyl-tRNA synthetase MetS (MetRS) (methionine--tRNA ligase) (Mycobacterium tuberculosis H37Rv)
MKPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDRYDVRFLTGTDEHGLKVAQAAA
AAGVPTAALARRNSDVFQRMQEALNISFDRFIRTTDADHHEASKELWRRMSAAGDIYLDN
YSGWYSVRDERFFVESETQLVDGTRLTVETGTPVTWTEEQTYFFRLSAYTDKLLAHYHAN
PDFIAPETRRNEVISFVSGGLDDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGAG
FPDTDSELFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNRGEKM
SKSVGNIVDPVALAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQ
RSLSMVAKNLDGRVPNPGEFADADAALLATADGLLERVRGHFDAQAMHLALEAIWLMLGD
ANKYFSVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQ
APNQRSFAAVGVRLTPGTALPPPTGVFPRYQPPQPPEGK