Protein Info for Rv0995 in Mycobacterium tuberculosis H37Rv

Annotation: Ribosomal-protein-alanine acetyltransferase RimJ (acetylating enzyme for N-terminal of ribosomal protein S5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 14 to 158 (145 residues), 54 bits, E=3.2e-18
• PF00583: Acetyltransf_1
  • amino acids 68 to 157 (90 residues), 34.5 bits, E=2.3e-12

Best Hits

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to mbb:BCG_1050)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Protein Sequence (203 amino acids)

>Rv0995 Ribosomal-protein-alanine acetyltransferase RimJ (acetylating enzyme for N-terminal of ribosomal protein S5) (Mycobacterium tuberculosis H37Rv)
MAVGPLRVSAGVIRLRPVRMRDGVHWSRIRLADRAHLEPWEPSADGEWTVRHTVAAWPAV
CSGLRSEARNGRMLPYVIELDGQFCGQLTIGNVTHGALRSAWIGYWVPSAATGGGVATGA
LALGLDHCFGPVMLHRVEATVRPENAASRAVLAKVGFREEGLLRRYLEVDRAWRDHLLMA
ITVEEVYGSVASTLVRAGHASWP