Protein Info for Rv0994 in Mycobacterium tuberculosis H37Rv

Annotation: Probable molybdopterin biosynthesis protein MoeA1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 314 to 333 (20 residues), see Phobius details PF03453: MoeA_N" amino acids 3 to 181 (179 residues), 121.1 bits, see alignment E=5.5e-39 TIGR00177: molybdenum cofactor synthesis domain" amino acids 191 to 329 (139 residues), 96.2 bits, see alignment E=8.8e-32 PF00994: MoCF_biosynth" amino acids 195 to 332 (138 residues), 84.1 bits, see alignment E=1.2e-27 PF03454: MoeA_C" amino acids 347 to 421 (75 residues), 57.7 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 100% identical to MOEA1_MYCTU: Molybdopterin molybdenumtransferase 1 (moeA1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to mtb:TBMG_02995)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>Rv0994 Probable molybdopterin biosynthesis protein MoeA1 (Mycobacterium tuberculosis H37Rv)
VRSVEEQQARISAAAVAPRPIRVAIAEAQGLMCAEEVVTERPMPGFDQAAIDGYAVRSVD
VAGVGDTGGVQVFADHGDLDGRDVLTLPVMGTIEAGARTLSRLQPRQAVRVQTGAPLPTL
ADAVLPLRWTDGGMSRVRVLRGAPSGAYVRRAGDDVQPGDVAVRAGTIIGAAQVGLLAAV
GRERVLVHPRPRLSVMAVGGELVDISRTPGNGQVYDVNSYALAAAGRDACAEVNRVGIVS
NDPTELGEIVEGQLNRAEVVVIAGGVGGAAAEAVRSVLSELGEMEVVRVAMHPGSVQGFG
QLGRDGVPTFLLPANPVSALVVFEVMVRPLIRLSLGKRHPMRRIVSARTLSPITSVAGRK
GYLRGQLMRDQDSGEYLVQALGGAPGASSHLLATLAEANCLVVVPTGAEQIRTGEIVDVA
FLAQHG