Protein Info for Rv0992c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 6 to 186 (181 residues), 111.7 bits, see alignment E=2e-36 PF01812: 5-FTHF_cyc-lig" amino acids 6 to 186 (181 residues), 172.5 bits, see alignment E=4.8e-55

Best Hits

Swiss-Prot: 58% identical to 5FCL_MYCS2: 5-formyltetrahydrofolate cyclo-ligase (MSMEG_5472) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_1019)

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>Rv0992c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MAMASKSALRDQLLAARRRVADDVRAAEARMLRGHLERMVTSDSTVCAYVPVGGEPGSIE
MLDVLLRRAGRVLLPVARTAGGDLPLPLRWGEYRAGGLARARWGLLEPPEPWLPEAALAQ
ASLVLVPALAVDRQGVRLGRGRGFYDRSLRCRDPHARLVAVVRTVELVDVLPSEPHDVPM
THALTPERGLIALPCGE