Protein Info for Rv0987 in Mycobacterium tuberculosis H37Rv

Annotation: Probable adhesion component transport transmembrane protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 855 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 305 to 330 (26 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details amino acids 485 to 507 (23 residues), see Phobius details amino acids 724 to 748 (25 residues), see Phobius details amino acids 772 to 800 (29 residues), see Phobius details amino acids 820 to 841 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 28 to 234 (207 residues), 52 bits, see alignment E=1.2e-17 PF02687: FtsX" amino acids 264 to 386 (123 residues), 67.8 bits, see alignment E=9e-23 amino acids 731 to 847 (117 residues), 57 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to mtb:TBMG_03002)

Predicted SEED Role

"AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (855 amino acids)

>Rv0987 Probable adhesion component transport transmembrane protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MNDQAPVAYAPLWRTAWRRLRQRPFQYILLVLGIALGVAMIVAIDVSSNSAQRAFDLSAA
AITGKSTHRLVSGPAGVDQQLYVDLRRHGYDFSAPVIEGYVLARGLGNRAMQFMGTDPFA
ESAFRSPLWSNQNIAELGGFLTRPNGVVLSRQVAQKYGLAVGDRIALQVKGAPTTVTLVG
LLTPADEVSNQKLSDLIIADISTAQELFHMPGRLSHIDLIIKDEATATRIQQRLPAGVRM
ETSDTQRDTVKQMTDAFTVNLTALSLIALLVGIFLIYNTVTFNVVQRRPFFAILRCLGVT
REQLFWLIMTESLVAGLIGTGLGLLIGIWLGEGLIGLVTQTINDFYFVINVRNVSVSAES
LLKGLIIGIFAAMLATLPPAIEAMRTVPASTLRRSSLESKITKLMPWLWVAWFGLGSFGV
LMLWLPGNNLVVAFVGLFSVLIALALIAPPLTRFVMLRLAPGLGRLLGPIGRMAPRNIVR
SLSRTSIAIAALMMAVSLMVGVSISVGSFRQTLANWLEVTLKSDVYVSPPTLTSGRPSGN
LPVDAVRNISKWPGVRDAVMARYSSVFAPDWGREVELMAVSGDISDGKRPYRWIDGNKDT
LWPRFLAGKGVMLSEPMVSRQHLQMPPRPITLMTDSGPQTFPVLAVFSDYTSDQGVILMD
RASYRAHWQDDDVTTMFLFLASGANSGALIDQLQAAFAGREDIVIQSTHSVREASMFIFD
RSFTITIALQLVATVVAFIGVLSALMSLELDRAHELGVFRAIGMTTRQLWKLMFIETGLM
GGMAGLMALPTGCILAWILVRIINVRSFGWTLQMHFESAHFLRALLVAVVAALAAGMYPA
WRLGRMTIRTAIREE