Protein Info for Rv0981 in Mycobacterium tuberculosis H37Rv

Annotation: Mycobacterial persistence regulator MRPA (two component response transcriptional regulatory protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 112.2 bits, see alignment E=1.5e-36 PF00486: Trans_reg_C" amino acids 149 to 223 (75 residues), 92.5 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 100% identical to MPRA_MYCTA: Response regulator MprA (mprA) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K07669, two-component system, OmpR family, response regulator MprA (inferred from 100% identity to mbt:JTY_1008)

Predicted SEED Role

"Mycobacterial persistence regulator MprA (Two component response transcriptional regulatory protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>Rv0981 Mycobacterial persistence regulator MRPA (two component response transcriptional regulatory protein) (Mycobacterium tuberculosis H37Rv)
VRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGL
EVCRQLRGTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTK
PEDAAESMAMRFSDLTLDPVTREVNRGQRRISLTRTEFALLEMLIANPRRVLTRSRILEE
VWGFDFPTSGNALEVYVGYLRRKTEADGEPRLIHTVRGVGYVLRETPP