Protein Info for Rv0978c in Mycobacterium tuberculosis H37Rv

Annotation: PE-PGRS family protein PE_PGRS17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00934: PE" amino acids 4 to 92 (89 residues), 99 bits, see alignment E=2.3e-32 PF21526: PGRS" amino acids 117 to 184 (68 residues), 43.2 bits, see alignment E=6.2e-15 PF01436: NHL" amino acids 217 to 243 (27 residues), 29.2 bits, see alignment (E = 1e-10) TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 228 to 268 (41 residues), 37.9 bits, see alignment 6.8e-14 amino acids 272 to 311 (40 residues), 36.2 bits, see alignment 2.2e-13

Best Hits

Swiss-Prot: 100% identical to PG17_MYCTU: PE-PGRS family protein PE_PGRS17 (PE_PGRS17) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_0985)

Predicted SEED Role

"PE_PGRS family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>Rv0978c PE-PGRS family protein PE_PGRS17 (Mycobacterium tuberculosis H37Rv)
MSFVNVAPQLVSTAAADAARIGSAINTANTAAAATTQVLAAAQDEVSTAIAALFGSHGQH
YQAISAQVAAYQQRFVLALSQAGSTYAVAEAASATPLQNVLDAINAPVQSLTGRPLIGDG
ANGIDGTGQAGGNGGWLWGNGGNGGSGAPGQAGGAGGAAGLIGNGGAGGTGGAVSLARAG
TAGGAGRGPVGGIGGAGGVGGAGGAAGAVTTITHASFNDPHGVAVNPGGNVYVTNFGSGT
VSVINPATNTVTGSPITIGNGPSGVAVSPVTGLVFVTNFDSNTVSVIDPTTNTVTGSPIT
VGTAPTGVAVNPVTGEVYVTNFAGDTVSVIS