Protein Info for Rv0974c in Mycobacterium tuberculosis H37Rv

Annotation: Probable acetyl-/propionyl-CoA carboxylase (beta subunit) AccD2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 PF01039: Carboxyl_trans" amino acids 46 to 519 (474 residues), 511.7 bits, see alignment E=2e-157 PF03255: ACCA" amino acids 81 to 199 (119 residues), 36.4 bits, see alignment E=3.5e-13

Best Hits

Swiss-Prot: 52% identical to MCCB_RAT: Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial (Mccc2) from Rattus norvegicus

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03014)

MetaCyc: 53% identical to methylcrotonyl-CoA carboxylase beta-subunit (Pseudomonas aeruginosa PAO1)
Methylcrotonoyl-CoA carboxylase. [EC: 6.4.1.4]

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase carboxyl transferase subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>Rv0974c Probable acetyl-/propionyl-CoA carboxylase (beta subunit) AccD2 (Mycobacterium tuberculosis H37Rv)
VLQSTLDPNASAYDEAAATMSGKLDEINAELAKALAGGGPKYVDRHHARGNLTPRERIEL
LVDPDSPFLELSPLAAYGSNFQIGASLVTGIGAVCGVECMIVANDPTVKGGTSNPWTLRK
ILRANQIAFENRLPVISLVESGGADLPTQKEIFIPGGQMFRDLTRLSAAGIPTIALVFGN
STAGGAYVPGMSDHVVMIKERSKVFLAGPPLVKMATGEESDDESLGGAEMHARISGLADY
FALDELDAIRIGRRIVARLNWIKQGPAPAPVTEPLFDAEELIGIVPPDLRIPFDPREVIA
RIVDGSEFDEFKPLYGSSLVTGWARLHGYPLGILANARGVLFSEESQKATQFIQLANRAD
TPLLFLHNTTGYMVGKDYEEGGMIKHGSMMINAVSNSTVPHISLLIGASYGAGHYGMCGR
AYDPRFLFAWPSAKSAVMGGAQLSGVLSIVARAAAEARGQQVDEAADAAMRAAVEGQIEA
ESLPLVLSGMLYDDGVIDPRDTRTVLGMCLSAIANGPIKGTSNFGVFRM