Protein Info for Rv0955 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 54 to 93 (40 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details PF19877: DUF6350" amino acids 50 to 374 (325 residues), 111.3 bits, see alignment E=3.1e-36

Best Hits

Swiss-Prot: 100% identical to Y955_MYCTU: Uncharacterized protein Rv0955 (Rv0955) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_0962)

Predicted SEED Role

"FIG021574: Possible membrane protein related to de Novo purine biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>Rv0955 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
VNRVSASADDRAAGARPARDLVRVAFGPGVVALGIIAAVTLLQLLIANSDMTGAWGAIAS
MWLGVHLVPISIGGRALGVMPLLPVLLMVWATARSTARATSPQSSGLVVRWVVASALGGP
LLMAAIALAVIHDASSVVTELQTPSALRAFTSVLVVHSVGAATGVWSRVGRRALAATALP
DWLHDSMRAAAAGVLALLGLSGVVTAGSLVVHWATMQELYGITDSIFGQFSLTVLSVLYA
PNVIVGTSAIAVGSSAHIGFATFSSFAVLGGDIPALPILAAAPTPPLGPAWVALLIVGAS
SGVAVGQQCARRALPFVAAMAKLLVAAVAGALVMAVLGYGGGGRLGNFGDVGVDEGALVL
GVLFWFTFVGWVTVVIAGGISRRPKRLRPAPPVELDADESSPPVDMFDGAASEQPPASVA
EDVPPSHDDIANGLKAPTADDEALPLSDEPPPRAD