Protein Info for Rv0952 in Mycobacterium tuberculosis H37Rv

Annotation: Probable succinyl-CoA synthetase (alpha chain) SucD (SCS-alpha)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 6 to 300 (295 residues), 443.8 bits, see alignment E=1.4e-137 PF02629: CoA_binding" amino acids 10 to 111 (102 residues), 87.3 bits, see alignment E=1.5e-28 PF13607: Succ_CoA_lig" amino acids 159 to 288 (130 residues), 42.8 bits, see alignment E=6.9e-15 PF00549: Ligase_CoA" amino acids 165 to 283 (119 residues), 69.8 bits, see alignment E=3.9e-23

Best Hits

Swiss-Prot: 100% identical to SUCD_MYCTO: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 100% identity to mbt:JTY_0976)

MetaCyc: 100% identical to Succinyl-CoA ligase [ADP-forming] alpha subunit (Mycobacterium tuberculosis H37Rv)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>Rv0952 Probable succinyl-CoA synthetase (alpha chain) SucD (SCS-alpha) (Mycobacterium tuberculosis H37Rv)
MTHMSIFLSRDNKVIVQGITGSEATVHTARMLRAGTQIVGGVNARKAGTTVTHEDKGGRL
IKLPVFGSVAEAMEKTGADVSIIFVPPTFAKDAIIEAIDAEIPLLVVITEGIPVQDTAYA
WAYNLEAGHKTRIIGPNCPGIISPGQSLAGITPANITGPGPIGLVSKSGTLTYQMMFELR
DLGFSTAIGIGGDPVIGTTHIDAIEAFERDPDTKLIVMIGEIGGDAEERAADFIKTNVSK
PVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKQEALEAAGVKVGKTPSATAALAREIL
LSL