Protein Info for Rv0949 in Mycobacterium tuberculosis H37Rv

Annotation: Probable ATP-dependent DNA helicase II UvrD1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 TIGR01073: ATP-dependent DNA helicase PcrA" amino acids 19 to 768 (750 residues), 923.8 bits, see alignment E=3.8e-282 PF00580: UvrD-helicase" amino acids 23 to 297 (275 residues), 310.2 bits, see alignment E=4e-96 PF13245: AAA_19" amino acids 27 to 282 (256 residues), 78.6 bits, see alignment E=1.3e-25 PF13361: UvrD_C" amino acids 302 to 652 (351 residues), 251.1 bits, see alignment E=5.4e-78 PF13538: UvrD_C_2" amino acids 593 to 651 (59 residues), 33.2 bits, see alignment 9.7e-12 PF21196: PcrA_UvrD_tudor" amino acids 723 to 770 (48 residues), 35.2 bits, see alignment 2.3e-12

Best Hits

Swiss-Prot: 100% identical to UVRD1_MYCTO: ATP-dependent DNA helicase UvrD1 (uvrD1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03657, DNA helicase II / ATP-dependent DNA helicase PcrA [EC: 3.6.4.12] (inferred from 100% identity to mtu:Rv0949)

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (771 amino acids)

>Rv0949 Probable ATP-dependent DNA helicase II UvrD1 (Mycobacterium tuberculosis H37Rv)
MSVHATDAKPPGPSPADQLLDGLNPQQRQAVVHEGSPLLIVAGAGSGKTAVLTRRIAYLM
AARGVGVGQILAITFTNKAAAEMRERVVGLVGEKARYMWVSTFHSTCVRILRNQAALIEG
LNSNFSIYDADDSRRLLQMVGRDLGLDIKRYSPRLLANAISNLKNELIDPHQALAGLTED
SDDLARAVASVYDEYQRRLRAANALDFDDLIGETVAVLQAFPQIAQYYRRRFRHVLVDEY
QDTNHAQYVLVRELVGRDSNDGIPPGELCVVGDADQSIYAFRGATIRNIEDFERDYPDTR
TILLEQNYRSTQNILSAANSVIARNAGRREKRLWTDAGAGELIVGYVADNEHDEARFVAE
EIDALAEGSEITYNDVAVFYRTNNSSRSLEEVLIRAGIPYKVVGGVRFYERKEIRDIVAY
LRVLDNPGDAVSLRRILNTPRRGIGDRAEACVAVYAENTGVGFGDALVAAAQGKVPMLNT
RAEKAIAGFVEMFDELRGRLDDDLGELVEAVLERTGYRRELEASTDPQELARLDNLNELV
SVAHEFSTDRENAAALGPDDEDVPDTGVLADFLERVSLVADADEIPEHGAGVVTLMTLHT
AKGLEFPVVFVTGWEDGMFPHMRALDNPTELSEERRLAYVGITRARQRLYVSRAIVRSSW
GQPMLNPESRFLREIPQELIDWRRTAPKPSFSAPVSGAGRFGSARPSPTRSGASRRPLLV
LQVGDRVTHDKYGLGRVEEVSGVGESAMSLIDFGSSGRVKLMHNHAPVTKL