Protein Info for Rv0948c in Mycobacterium tuberculosis H37Rv

Annotation: Chorismate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 TIGR01808: chorismate mutase" amino acids 28 to 101 (74 residues), 131.9 bits, see alignment E=3.5e-43 PF01817: CM_2" amino acids 32 to 88 (57 residues), 47.4 bits, see alignment E=9.4e-17

Best Hits

Swiss-Prot: 100% identical to CHMU_MYCTU: Intracellular chorismate mutase (Rv0948c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mtb:TBMG_03040)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.5

Use Curated BLAST to search for 5.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>Rv0948c Chorismate mutase (Mycobacterium tuberculosis H37Rv)
MRPEPPHHENAELAAMNLEMLESQPVPEIDTLREEIDRLDAEILALVKRRAEVSKAIGKA
RMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH