Protein Info for Rv0948c in Mycobacterium tuberculosis H37Rv
Annotation: Chorismate mutase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CHMU_MYCTU: Intracellular chorismate mutase (Rv0948c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: None (inferred from 99% identity to mtb:TBMG_03040)Predicted SEED Role
"Chorismate mutase I (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis II (3/4 steps found)
- L-tyrosine biosynthesis III (3/4 steps found)
- superpathway of L-phenylalanine and L-tyrosine biosynthesis (3/5 steps found)
- L-phenylalanine biosynthesis II (2/4 steps found)
- superpathway of chorismate metabolism (40/59 steps found)
- bacilysin biosynthesis (1/10 steps found)
- salinosporamide A biosynthesis (4/15 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 5.4.99.5
Use Curated BLAST to search for 5.4.99.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (105 amino acids)
>Rv0948c Chorismate mutase (Mycobacterium tuberculosis H37Rv) MRPEPPHHENAELAAMNLEMLESQPVPEIDTLREEIDRLDAEILALVKRRAEVSKAIGKA RMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH