Protein Info for Rv0945 in Mycobacterium tuberculosis H37Rv

Annotation: Probable short-chain type dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 9 to 202 (194 residues), 148.7 bits, see alignment E=2.9e-47 PF01370: Epimerase" amino acids 10 to 192 (183 residues), 23.4 bits, see alignment E=7.5e-09 PF08659: KR" amino acids 10 to 170 (161 residues), 46.4 bits, see alignment E=9.1e-16 PF13561: adh_short_C2" amino acids 14 to 204 (191 residues), 102.6 bits, see alignment E=5.2e-33

Best Hits

Swiss-Prot: 100% identical to Y945_MYCTO: Uncharacterized oxidoreductase MT0971 (MT0971) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbb:BCG_0999)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>Rv0945 Probable short-chain type dehydrogenase/reductase (Mycobacterium tuberculosis H37Rv)
MLTGVTRQKILITGASSGLGAGMARSFAAQGRDLALCARRTDRLTELKAELSQRYPDIKI
AVAELDVNDHERVPKVFAELSDEIGGIDRVIVNAGIGKGARLGSGKLWANKATIETNLVA
ALVQIETALDMFNQRGSGHLVLISSVLGVKGVPGVKAAYAASKAGVRSLGESLRAEYAQR
PIRVTVLEPGYIESEMTAKSASTMLMVDNATGVKALVAAIEREPGRAAVPWWPWAPLVRL
MWVLPPRLTRRFA