Protein Info for Rv0935 in Mycobacterium tuberculosis H37Rv

Annotation: Phosphate-transport integral membrane ABC transporter PstC1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 86 to 113 (28 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 258 to 285 (28 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 14 to 327 (314 residues), 330 bits, see alignment E=5.6e-103 PF00528: BPD_transp_1" amino acids 103 to 328 (226 residues), 43.8 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 100% identical to PSTC1_MYCBO: Phosphate transport system permease protein PstC 1 (pstC1) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to mbo:Mb0960)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>Rv0935 Phosphate-transport integral membrane ABC transporter PstC1 (Mycobacterium tuberculosis H37Rv)
MLARAGEVGRAGPAIRWLGGIGAVIPLLALVLVLVVLVIEAMGAIRLNGLHFFTATEWNP
GNTYGETVVTDGVAHPVGAYYGALPLIVGTLATSAIALIIAVPVSVGAALVIVERLPKRL
AEAVGIVLELLAGIPSVVVGLWGAMTFGPFIAHHIAPVIAHNAPDVPVLNYLRGDPGNGE
GMLVSGLVLAVMVVPIIATTTHDLFRQVPVLPREGAIALGMSNWECVRRVTLPWVSSGIV
GAVVLGLGRALGETMAVAMVSGAVLGAMPANIYATMTTIAATIVSQLDSAMTDSTNFAVK
TLAEVGLVLMVITLLTNVAARGMVRRVSRTALPVGRGI