Protein Info for Rv0934 in Mycobacterium tuberculosis H37Rv

Annotation: Periplasmic phosphate-binding lipoprotein PstS1 (PBP-1) (PstS1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12849: PBP_like_2" amino acids 45 to 342 (298 residues), 108 bits, see alignment E=7.4e-35 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 53 to 372 (320 residues), 417.9 bits, see alignment E=1.2e-129 PF01547: SBP_bac_1" amino acids 70 to 345 (276 residues), 105.4 bits, see alignment E=6.1e-34

Best Hits

Swiss-Prot: 100% identical to PSTS1_MYCTU: Phosphate-binding protein PstS 1 (pstS1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to mbo:Mb0959)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>Rv0934 Periplasmic phosphate-binding lipoprotein PstS1 (PBP-1) (PstS1) (Mycobacterium tuberculosis H37Rv)
VKIRLHTLLAVLTAAPLLLAAAGCGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTL
LYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGL
MNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAV
VPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAE
TPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISM
IDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPA
VVKLSDALIATISS