Protein Info for Rv0933 in Mycobacterium tuberculosis H37Rv

Annotation: Phosphate-transport ATP-binding protein ABC transporter PstB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 22 to 266 (245 residues), 351.6 bits, see alignment E=1.1e-109 PF00005: ABC_tran" amino acids 37 to 192 (156 residues), 97 bits, see alignment E=1.5e-31 PF13304: AAA_21" amino acids 157 to 222 (66 residues), 39.7 bits, see alignment E=5.8e-14

Best Hits

Swiss-Prot: 100% identical to PSTB2_MYCTO: Phosphate import ATP-binding protein PstB 2 (pstB2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to mtc:MT0960)

MetaCyc: 44% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>Rv0933 Phosphate-transport ATP-binding protein ABC transporter PstB (Mycobacterium tuberculosis H37Rv)
MACERLGGQSGAADVDAAAPAMAAVNLTLGFAGKTVLDQVSMGFPARAVTSLMGPTGSGK
TTFLRTLNRMNDKVSGYRYSGDVLLGGRSIFNYRDVLEFRRRVGMLFQRPNPFPMSIMDN
VLAGVRAHKLVPRKEFRGVAQARLTEVGLWDAVKDRLSDSPFRLSGGQQQLLCLARTLAV
NPEVLLLDEPTSALDPTTTEKIEEFIRSLADRLTVIIVTHNLAQAARISDRAALFFDGRL
VEEGPTEQLFSSPKHAETARYVAGLSGDVKDAKRGN