Protein Info for Rv0932c in Mycobacterium tuberculosis H37Rv

Annotation: Periplasmic phosphate-binding lipoprotein PstS2 (PBP-2) (PstS2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF12849: PBP_like_2" amino acids 47 to 335 (289 residues), 137 bits, see alignment E=1.1e-43 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 50 to 369 (320 residues), 330.9 bits, see alignment E=3.6e-103 PF01547: SBP_bac_1" amino acids 53 to 343 (291 residues), 58.9 bits, see alignment E=8.7e-20

Best Hits

Swiss-Prot: 100% identical to PSTS2_MYCTU: Phosphate-binding protein PstS 2 (pstS2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to mbo:Mb0956c)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>Rv0932c Periplasmic phosphate-binding lipoprotein PstS2 (PBP-2) (PstS2) (Mycobacterium tuberculosis H37Rv)
VKFARSGAAVSLLAAGTLVLTACGGGTNSSSSGAGGTSGSVHCGGKKELHSSGSTAQENA
MEQFVYAYVRSCPGYTLDYNANGSGAGVTQFLNNETDFAGSDVPLNPSTGQPDRSAERCG
SPAWDLPTVFGPIAITYNIKGVSTLNLDGPTTAKIFNGTITVWNDPQIQALNSGTDLPPT
PISVIFRSDKSGTSDNFQKYLDGASNGAWGKGASETFNGGVGVGASGNNGTSALLQTTDG
SITYNEWSFAVGKQLNMAQIITSAGPDPVAITTESVGKTIAGAKIMGQGNDLVLDTSSFY
RPTQPGSYPIVLATYEIVCSKYPDATTGTAVRAFMQAAIGPGQEGLDQYGSIPLPKSFQA
KLAAAVNAIS